McDonnell Genome Institute

Washington University

Transcript

lnc-PSD3-1:10

Chromosome

chr8

Gene Name

lnc-PSD3-1

Start

19182066

CPC Label

noncoding

End

19186656

Cancer

EOGC

Strand

-

Peptide

LEGWDHSGGEK

Modified Peptide

n[145]LEGWDHSGGEK

Peptide Length

11

ORF Length

43

Open Reading Frame (ORF)

MKRLEGWDHSGGEKRGSIKPLPLGQPAEHLPGLGPWPYHTSVQ

Conservation Score

0.146

PhyloCSF Frame 1

-4.773

No. of Spectra

1

CPC Coding Probability

0.0321544

PhyloCSF Frame 2 

-3.913

CNTI Index

noncoding

Max Probability

0.9982

PhyloCSF Frame 3

-4.486

CNTI Score

-0.323866526