McDonnell Genome Institute

Washington University

Transcript

lnc-PSD-2:1

Chromosome

chr10

Gene Name

lnc-PSD-2

Start

102391709

CPC Label

noncoding

End

102395588

Cancer

CCRC

Strand

-

Peptide

DSGAAGK

Modified Peptide

n[230]DSGAAGK

Peptide Length

7

ORF Length

137

Open Reading Frame (ORF)

LAVWGQVRLPLPSPGLEQPWDFLPGGRPRLINPGGFWGDIPAVGRPPLRTACRRGLFPVGGPGVLPRERDSGAAGKVSPPRSGLFSLSPKPHNSSWSHTAPVLGAQATGRSLHAPPPPPPPNTRVCLHHSSTSVFRL

Conservation Score

1

PhyloCSF Frame 1

-1.004

No. of Spectra

2

CPC Coding Probability

0.153491

PhyloCSF Frame 2 

-1.371

CNTI Index

noncoding

Max Probability

0.9954

PhyloCSF Frame 3

-0.58

CNTI Score

-0.278686111