McDonnell Genome Institute

Washington University

Transcript

lnc-PSAPL1-1:1

Chromosome

chr4

Gene Name

lnc-PSAPL1-1

Start

7430293

CPC Label

noncoding

End

7431577

Cancer

OV

Strand

-

Peptide

GAVGAWK

Modified Peptide

n[145]GAVGAWK

Peptide Length

7

ORF Length

108

Open Reading Frame (ORF)

LRRTEEHLCLGGGRGLPPGCQSRASTCTFSQTHAGHSSDAIVRRRPGTSQNTYGCCPSGFLGHTRCRGAVGAWKRAWWSSCFVVVVFVLFVCLFVCFGLGLFLEVMCC

Conservation Score

0.07

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.112099

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9179

PhyloCSF Frame 3

0

CNTI Score

-0.303151475