McDonnell Genome Institute

Washington University

Transcript

lnc-PRY-1:3

Chromosome

chrY

Gene Name

lnc-PRY-1

Start

22438939

CPC Label

noncoding

End

22484714

Cancer

OV

Strand

+

Peptide

MSLGEGR

Modified Peptide

n[145]MSLGEGR

Peptide Length

7

ORF Length

79

Open Reading Frame (ORF)

MSLGEGRCKPACSSIKKRPRNKPQYFSGSRNICNIFQMCLDIVEKEEEHTTAKIRHLPVFCCPVVNPGRKYSSTVCKAA

Conservation Score

0.016

PhyloCSF Frame 1

0

No. of Spectra

26

CPC Coding Probability

0.056119

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9518

PhyloCSF Frame 3

0

CNTI Score

-0.368404105