McDonnell Genome Institute

Washington University

Transcript

lnc-PRTG-2:1

Chromosome

chr15

Gene Name

lnc-PRTG-2

Start

55924362

CPC Label

noncoding

End

55966546

Cancer

EOGC

Strand

-

Peptide

VTLYDPMNGVLTSVQTK

Modified Peptide

n[145]VTLYDPMNGVLTSVQTK

Peptide Length

17

ORF Length

82

Open Reading Frame (ORF)

LGASDPYVRVTLYDPMNGVLTSVQTKTIKKSLNPKWNEEILFRKIILEGPKKLFTVFALGVGQRFILSSTGFFLKCLTKTDW

Conservation Score

1

PhyloCSF Frame 1

-0.481

No. of Spectra

5

CPC Coding Probability

0.115842

PhyloCSF Frame 2 

-2.72

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

9.081

CNTI Score

-0.425903638