McDonnell Genome Institute

Washington University

Transcript

lnc-PRSS54-2:1

Chromosome

chr16

Gene Name

lnc-PRSS54-2

Start

58392152

CPC Label

noncoding

End

58392807

Cancer

OV

Strand

-

Peptide

GMAVSVRTGSFSWDIRMSSK

Modified Peptide

n[145]GM[147]AVSVRTGSFSWDIRMSSK

Peptide Length

20

ORF Length

53

Open Reading Frame (ORF)

LSVSAPALRSRKKAPRRGMAVSVRTGSFSWDIRMSSKERKFSSGPSAPDSTRK

Conservation Score

1

PhyloCSF Frame 1

-3.368

No. of Spectra

2

CPC Coding Probability

0.0269461

PhyloCSF Frame 2 

10.498

CNTI Index

noncoding

Max Probability

0.1042

PhyloCSF Frame 3

-3.926

CNTI Score

-0.336295396