McDonnell Genome Institute

Washington University

Transcript

lnc-PRSS51-4:4

Chromosome

chr8

Gene Name

lnc-PRSS51-4

Start

10050484

CPC Label

noncoding

End

10054254

Cancer

OV

Strand

-

Peptide

LALSELEGLK

Modified Peptide

n[145]LALSELEGLK

Peptide Length

10

ORF Length

92

Open Reading Frame (ORF)

LALSELEGLKSPLSQFVLQTTGRELHLSMTLFPSSSVNKMTSFYLSSSFSKYFAKETGRRQYCLTDPEIHSQPFSLLLQIQRAGSLPAKVLS

Conservation Score

0.911

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.146665

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.7101

PhyloCSF Frame 3

0

CNTI Score

0.617232134