McDonnell Genome Institute

Washington University

Transcript

lnc-PRSS50-1:1

Chromosome

chr3

Gene Name

lnc-PRSS50-1

Start

46754483

CPC Label

coding

End

46812574

Cancer

OV

Strand

-

Peptide

GGATTEAEVAGSIHGVPER

Modified Peptide

n[145]GGATTEAEVAGSIHGVPER

Peptide Length

19

ORF Length

104

Open Reading Frame (ORF)

LRGGATTEAEVAGSIHGVPERQLPGAPGLVLASSAMARRGPGRQGGCAGRRSTALPLRAPLRARRPGPRSERMGAATCRGSRIPSGPPVQGERSAPRFGVTSLR

Conservation Score

0.077

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.997663

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8845

PhyloCSF Frame 3

0

CNTI Score

-0.309487721