McDonnell Genome Institute

Washington University

Transcript

lnc-PRSS3-2:3

Chromosome

chr9

Gene Name

lnc-PRSS3-2

Start

33677267

CPC Label

noncoding

End

33688010

Cancer

PRAD

Strand

+

Peptide

HVCFWLLAR

Modified Peptide

HVCFWLLAR

Peptide Length

9

ORF Length

120

Open Reading Frame (ORF)

LKAALSTSLLLMFWDSDWLPGSSACRRPIVGLYLVFVGPMKEQETQLWKHTFFPLLMFMTPPIPYCISIFGHSTQHVFLFPLPLPRHVCFWLLARAVLPSLSEWPHCRLQPFMRNKALPS

Conservation Score

0.629

PhyloCSF Frame 1

0

No. of Spectra

20

CPC Coding Probability

0.301586

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

0

CNTI Score

-0.292202008