McDonnell Genome Institute

Washington University

Transcript

lnc-PRSS27-4:7

Chromosome

chr16

Gene Name

lnc-PRSS27-4

Start

2658388

CPC Label

coding

End

2673439

Cancer

OSCC

Strand

-

Peptide

EALGAETVPQAGAR

Modified Peptide

n[145]EALGAETVPQAGAR

Peptide Length

14

ORF Length

125

Open Reading Frame (ORF)

LRGCVWKRVGTGVALSPSVEMDLDRMPRSAAVLCGAGCGCREALGAETVPQAGARVRVLYAAPHLPCDDMWSPGCPAQLFRKQVQRAVCWEEVLLWKLQVLDMSCSGLFSRSFFYNRIALFTCSV

Conservation Score

1

PhyloCSF Frame 1

-4.031

No. of Spectra

3

CPC Coding Probability

0.999981

PhyloCSF Frame 2 

-3.459

CNTI Index

noncoding

Max Probability

0.3182

PhyloCSF Frame 3

-5.089

CNTI Score

-0.325609439