McDonnell Genome Institute

Washington University

Transcript

lnc-PRSS27-4:6

Chromosome

chr16

Gene Name

lnc-PRSS27-4

Start

2661148

CPC Label

coding

End

2673441

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

MMAMAILVNK

Modified Peptide

n[145]M[147]MAMAILVNK

Peptide Length

10

ORF Length

34

Open Reading Frame (ORF)

MMAMAILVNKKGGDVGGKPPRHRGKRQRTRAVPV

Conservation Score

0.347

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.999999

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7846

PhyloCSF Frame 3

0

CNTI Score

-0.325609439