McDonnell Genome Institute

Washington University

Transcript

lnc-PRSS27-4:25

Chromosome

chr16

Gene Name

lnc-PRSS27-4

Start

2642292

CPC Label

noncoding

End

2661825

Cancer

OV

Strand

-

Peptide

IIVVTGIINIGMLMLSPFSLQMPLR

Modified Peptide

n[145]IIVVTGIINIGM[147]LM[147]LSPFSLQMPLR

Peptide Length

25

ORF Length

48

Open Reading Frame (ORF)

MAQTRQRIIVVTGIINIGMLMLSPFSLQMPLRSPKPSPKSTTSNDGDV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.464369

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5984

PhyloCSF Frame 3

0

CNTI Score

-0.319098549