McDonnell Genome Institute

Washington University

Transcript

lnc-PRSS27-4:24

Chromosome

chr16

Gene Name

lnc-PRSS27-4

Start

2660349

CPC Label

coding

End

2665350

Cancer

LUAD

Strand

-

Peptide

HGQLLTQR

Modified Peptide

n[230]HGQLLTQR

Peptide Length

8

ORF Length

65

Open Reading Frame (ORF)

LITAPPTLVLLLKSFLRHGQLLTQRAFPITLENRPWLNEPIKHSKINFVNRILNQREMLLLLMPN

Conservation Score

0.345

PhyloCSF Frame 1

0

No. of Spectra

59

CPC Coding Probability

1

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9972

PhyloCSF Frame 3

0

CNTI Score

0.591019203