McDonnell Genome Institute

Washington University

Transcript

lnc-PRSS27-4:12

Chromosome

chr16

Gene Name

lnc-PRSS27-4

Start

2650587

CPC Label

coding

End

2673415

Cancer

HCC

Strand

-

Peptide

LVALCLPWVSER

Modified Peptide

n[230]LVALCLPWVSER

Peptide Length

12

ORF Length

82

Open Reading Frame (ORF)

LQRNLVLWCFIICLCDKYTTLMLKMWVSEIETWRFLRLAARLSLRTRLEAVGSPRLVALCLPWVSERLLGRPVEMAVGGQIE

Conservation Score

0.428

PhyloCSF Frame 1

-4.434

No. of Spectra

2

CPC Coding Probability

0.997951

PhyloCSF Frame 2 

-3.314

CNTI Index

coding

Max Probability

0.9988

PhyloCSF Frame 3

-4.823

CNTI Score

0.668003554