McDonnell Genome Institute

Washington University

Transcript

lnc-PRSS23-1:10

Chromosome

chr11

Gene Name

lnc-PRSS23-1

Start

86955622

CPC Label

noncoding

End

86971710

Cancer

EOGC

Strand

+

Peptide

LFLSTAFLSSR

Modified Peptide

n[145]LFLSTAFLSSR

Peptide Length

11

ORF Length

49

Open Reading Frame (ORF)

MKKPLPYQKLFLSTAFLSSRGTHHQYFPKKKARGITFQSECGKTTKTIT

Conservation Score

1

PhyloCSF Frame 1

-4.478

No. of Spectra

2

CPC Coding Probability

0.483094

PhyloCSF Frame 2 

-3.516

CNTI Index

noncoding

Max Probability

0.9978

PhyloCSF Frame 3

-2.63

CNTI Score

-0.314816266