McDonnell Genome Institute

Washington University

Transcript

lnc-PRRT3-3:1

Chromosome

chr3

Gene Name

lnc-PRRT3-3

Start

9931496

CPC Label

noncoding

End

9933632

Cancer

EOGC

Strand

-

Peptide

GELAQAWLPGGGPPPSACSHSPPER

Modified Peptide

n[145]GELAQAWLPGGGPPPSACSHSPPER

Peptide Length

25

ORF Length

102

Open Reading Frame (ORF)

LSRGAEPRGPWRPLPEKTDGEGRGELAQAWLPGGGPPPSACSHSPPERTSCFKSLSHPVRGEGRRQPVSSAAAFPRRTPTATLVLPQGNGEPGSAHLSRDPF

Conservation Score

1

PhyloCSF Frame 1

-0.653

No. of Spectra

4

CPC Coding Probability

0.292411

PhyloCSF Frame 2 

-2.785

CNTI Index

coding

Max Probability

0.0827

PhyloCSF Frame 3

11.78

CNTI Score

0.780453568