McDonnell Genome Institute

Washington University

Transcript

lnc-PRRG4-4:1

Chromosome

chr11

Gene Name

lnc-PRRG4-4

Start

32758267

CPC Label

noncoding

End

32758614

Cancer

EOGC

Strand

+

Peptide

MVQHLTYHHGLSYNTASNK

Modified Peptide

n[145]M[147]VQHLTYHHGLSYNTASNK

Peptide Length

19

ORF Length

68

Open Reading Frame (ORF)

MVQHLTYHHGLSYNTASNKTRLSQTPGNRIVYLYTKKVRKAPKSPRGMPPSRFQGVCAVRPKVLMRLS

Conservation Score

1

PhyloCSF Frame 1

-4.493

No. of Spectra

17

CPC Coding Probability

0.126759

PhyloCSF Frame 2 

-3.568

CNTI Index

noncoding

Max Probability

0.7835

PhyloCSF Frame 3

-4.917

CNTI Score

-0.421721694