McDonnell Genome Institute

Washington University

Transcript

lnc-PRRC2C-5:1

Chromosome

chr1

Gene Name

lnc-PRRC2C-5

Start

171600881

CPC Label

noncoding

End

171601812

Cancer

OV

Strand

+

Peptide

LLCGASLQGTPASLSEAIR

Modified Peptide

n[145]LLCGASLQGTPASLSEAIR

Peptide Length

19

ORF Length

64

Open Reading Frame (ORF)

LLCGASLQGTPASLSEAIRRAIPGRELPRWNASPEQCVAGPCGGLTQWLNTRKELALGVQTSEI

Conservation Score

0.155

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0158997

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8141

PhyloCSF Frame 3

0

CNTI Score

-0.338992357