McDonnell Genome Institute

Washington University

Transcript

lnc-PRRC2B-4:1

Chromosome

chr9

Gene Name

lnc-PRRC2B-4

Start

131369784

CPC Label

noncoding

End

131370027

Cancer

EOGC

Strand

+

Peptide

CAIILCLAK

Modified Peptide

n[145]CAIILCLAK

Peptide Length

9

ORF Length

80

Open Reading Frame (ORF)

MDPFQKSLNKFYKNSPWCKCAIILCLAKFLCVTLVRCCSTTESRRSVISCIGVHILAQSVTRWENYFSSPQFPHLLLLLL

Conservation Score

0.122

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.0861363

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9986

PhyloCSF Frame 3

0

CNTI Score

-0.412416693