McDonnell Genome Institute

Washington University

Transcript

lnc-PRR7-4:2

Chromosome

chr5

Gene Name

lnc-PRR7-4

Start

177517078

CPC Label

noncoding

End

177521050

Cancer

BRCA-Luminal B

Strand

+

Peptide

LDSGAAQGSQGAPALK

Modified Peptide

n[145]LDSGAAQGSQGAPALK

Peptide Length

16

ORF Length

51

Open Reading Frame (ORF)

LDSGAAQGSQGAPALKAVLAAGSLSCPWGAEGPGSLLLRPREELAWHWKEE

Conservation Score

0.142

PhyloCSF Frame 1

-4.078

No. of Spectra

8

CPC Coding Probability

0.0515809

PhyloCSF Frame 2 

-5.09

CNTI Index

noncoding

Max Probability

0.9949

PhyloCSF Frame 3

-3.214

CNTI Score

-0.333133376