McDonnell Genome Institute

Washington University

Transcript

lnc-PRR5-2:1

Chromosome

chr22

Gene Name

lnc-PRR5-2

Start

44651834

CPC Label

noncoding

End

44652379

Cancer

OSCC

Strand

+

Peptide

YQTPPAVLK

Modified Peptide

n[145]YQTPPAVLK

Peptide Length

9

ORF Length

62

Open Reading Frame (ORF)

MRRRLHVELKYQTPPAVLKLVLDNCQSSDGKIEGFTVEFVNLEFLHLITAGLISFSNLPWLP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0906392

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9788

PhyloCSF Frame 3

0

CNTI Score

0.729015645