McDonnell Genome Institute

Washington University

Transcript

lnc-PRR26-2:1

Chromosome

chr10

Gene Name

lnc-PRR26-2

Start

628637

CPC Label

noncoding

End

631255

Cancer

OV

Strand

+

Peptide

APQWGILAELQGK

Modified Peptide

n[145]APQWGILAELQGK

Peptide Length

13

ORF Length

115

Open Reading Frame (ORF)

LMPRPRHAYLLAGISLRPVWHRQRQGPALGAQGWQSRVIEAGGVQTVASPQELLALRELRAPQWGILAELQGKAGWRPGSSAPISSAPTLEGGQISMLTFVLTQLIQTIHKNKLA

Conservation Score

0.097

PhyloCSF Frame 1

-4.69

No. of Spectra

5

CPC Coding Probability

0.195954

PhyloCSF Frame 2 

-5.217

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

-4.788

CNTI Score

-0.314776306