McDonnell Genome Institute

Washington University

Transcript

lnc-PRR23D2-2:1

Chromosome

chr8

Gene Name

lnc-PRR23D2-2

Start

7696829

CPC Label

noncoding

End

7697093

Cancer

CCRC

Strand

-

Peptide

ALDSNMQTLVYENYNK

Modified Peptide

n[230]ALDSNM[147]QTLVYENYNK

Peptide Length

16

ORF Length

80

Open Reading Frame (ORF)

MLKFYNGLSEVEAVGLPAGTEPLDPTDLNGVHFDPEVYLDKLPRECPLAQLMDSETDMVQQIRALDSNMQTLVYENYNKF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.0427676

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9995

PhyloCSF Frame 3

0

CNTI Score

0.691059194