McDonnell Genome Institute

Washington University

Transcript

lnc-PRR20E-3:1

Chromosome

chr13

Gene Name

lnc-PRR20E-3

Start

57314738

CPC Label

noncoding

End

57315909

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

AAGAPIEWLK

Modified Peptide

n[145]AAGAPIEWLK

Peptide Length

10

ORF Length

81

Open Reading Frame (ORF)

LAGGVVTAISKAAGAPIEWLKLLLQVQHATKEITTDKQYKHIIDCVVCIPKEERVLSFWRGNLANVIRYFPTQGLSTSPSK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.434206

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4761

PhyloCSF Frame 3

0

CNTI Score

-0.315724244