McDonnell Genome Institute

Washington University

Transcript

lnc-PRR20E-2:1

Chromosome

chr13

Gene Name

lnc-PRR20E-2

Start

57204378

CPC Label

noncoding

End

57204799

Cancer

OV

Strand

+

Peptide

ASTAMITQSR

Modified Peptide

n[145]ASTAMITQSR

Peptide Length

10

ORF Length

83

Open Reading Frame (ORF)

LTICNSYNRCRASTAMITQSRQLNSPPYRNINSHTNFIKCFTFMSYIIIRPEKRPNSRMFKQNKLNIYTTKTLRRPMHRNLRV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.083015

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5256

PhyloCSF Frame 3

0

CNTI Score

-0.436731557