McDonnell Genome Institute

Washington University

Transcript

lnc-PRR20C-5:1

Chromosome

chr13

Gene Name

lnc-PRR20C-5

Start

55578354

CPC Label

noncoding

End

55672504

Cancer

EOGC

Strand

+

Peptide

AGLATKVEGEGVEGYLPLPQK

Modified Peptide

n[145]AGLATKVEGEGVEGYLPLPQK

Peptide Length

21

ORF Length

125

Open Reading Frame (ORF)

MGHGNKGSGHGNKGSGHGNKGSRHGNKGLEHRDMRLGYLPPPLEKWDLPLRVKEKGLRGTCPSPRKAGLATKVEGEGVEGYLPLPQKSREGVETRREGVGVLAPFPEKRDLSLRVKDHGRHPCVV

Conservation Score

0.274

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.187491

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.845

PhyloCSF Frame 3

0

CNTI Score

-0.359065617