McDonnell Genome Institute

Washington University

Transcript

lnc-PRR16-1:2

Chromosome

chr5

Gene Name

lnc-PRR16-1

Start

120780039

CPC Label

noncoding

End

120781411

Cancer

OV

Strand

+

Peptide

LSCTDSQTYHGMELTYEPQTPK

Modified Peptide

n[145]LSCTDSQTYHGM[147]ELTYEPQTPK

Peptide Length

22

ORF Length

66

Open Reading Frame (ORF)

LLLLFTERKTESQKLSCTDSQTYHGMELTYEPQTPKTSHPTRFMAEASETRLTRLTRLTREKHTNF

Conservation Score

0.382

PhyloCSF Frame 1

0

No. of Spectra

24

CPC Coding Probability

0.0327912

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5103

PhyloCSF Frame 3

0

CNTI Score

-0.438043972