McDonnell Genome Institute

Washington University

Transcript

lnc-PRR14L-5:3

Chromosome

chr22

Gene Name

lnc-PRR14L-5

Start

31934347

CPC Label

coding

End

31938454

Cancer

OV

Strand

-

Peptide

ALDFLSVK

Modified Peptide

n[145]ALDFLSVK

Peptide Length

8

ORF Length

98

Open Reading Frame (ORF)

MVPTGWAGLGGAVVHGPGKLEKAVPSPRALDFLSVKWEAAMMNGKVPFFFSSESLGYFATGRPADNVMTTQEDTTGLHQKTSLWTMSRPGAKKVSVST

Conservation Score

0.444

PhyloCSF Frame 1

-4.658

No. of Spectra

5

CPC Coding Probability

0.586575

PhyloCSF Frame 2 

-3.154

CNTI Index

noncoding

Max Probability

0.9896

PhyloCSF Frame 3

-4.511

CNTI Score

-0.392070658