McDonnell Genome Institute

Washington University

Transcript

lnc-PRPS1-3:2

Chromosome

chrX

Gene Name

lnc-PRPS1-3

Start

107673199

CPC Label

noncoding

End

107673550

Cancer

EOGC

Strand

+

Peptide

IVWGEMEAVQQK

Modified Peptide

n[145]IVWGEMEAVQQK

Peptide Length

12

ORF Length

51

Open Reading Frame (ORF)

LSSPLRSKLASLFSSEKTDRRYPVFRIVWGEMEAVQQKDHRFKCSGLGFKS

Conservation Score

0.304

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.00615334

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9872

PhyloCSF Frame 3

-5.44

CNTI Score

-0.403828797