McDonnell Genome Institute

Washington University

Transcript

lnc-PRPF38A-1:1

Chromosome

chr1

Gene Name

lnc-PRPF38A-1

Start

52253620

CPC Label

coding

End

52254176

Cancer

HCC

Strand

+

Peptide

APPGTDPEQLEK

Modified Peptide

n[230]APPGTDPEQLEK

Peptide Length

12

ORF Length

157

Open Reading Frame (ORF)

MTTPNKAPPGTDPEQLEKTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLYIYADYKSDESYTPSKISAKVGNNFHNLQEIRQLELVEPSGWIHIPLTDNHRKPTWTLMIQIAVLASHQNGKDTHPYETN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.980823

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6919

PhyloCSF Frame 3

0

CNTI Score

-0.367693831