McDonnell Genome Institute

Washington University

Transcript

lnc-PRPF18-7:4

Chromosome

chr10

Gene Name

lnc-PRPF18-7

Start

14011420

CPC Label

noncoding

End

14018166

Cancer

OV

Strand

+

Peptide

IRCPRISLDLSGK

Modified Peptide

n[145]IRCPRISLDLSGK

Peptide Length

13

ORF Length

41

Open Reading Frame (ORF)

LQGREENAPSAAWKPHVKIRCPRISLDLSGKDLAIENVKYE

Conservation Score

0.13

PhyloCSF Frame 1

-5.494

No. of Spectra

2

CPC Coding Probability

0.063613

PhyloCSF Frame 2 

-4.577

CNTI Index

noncoding

Max Probability

0.7635

PhyloCSF Frame 3

-4.133

CNTI Score

-0.378839773