McDonnell Genome Institute

Washington University

Transcript

lnc-PROSER1-3:1

Chromosome

chr13

Gene Name

lnc-PROSER1-3

Start

39525878

CPC Label

noncoding

End

39533419

Cancer

OV

Strand

-

Peptide

LINFSKSQIPHLCVGGK

Modified Peptide

n[145]LINFSKSQIPHLCVGGK

Peptide Length

17

ORF Length

45

Open Reading Frame (ORF)

LKHLLLLVGKLINFSKSQIPHLCVGGKNIQQNQPNKVYSLLLLCL

Conservation Score

0.972

PhyloCSF Frame 1

-3.837

No. of Spectra

3

CPC Coding Probability

0.0784942

PhyloCSF Frame 2 

-2.404

CNTI Index

noncoding

Max Probability

0.8911

PhyloCSF Frame 3

-4.858

CNTI Score

-0.381208562