McDonnell Genome Institute

Washington University

Transcript

lnc-PRORY-6:1

Chromosome

chrY

Gene Name

lnc-PRORY-6

Start

21038288

CPC Label

coding

End

21044724

Cancer

HCC

Strand

-

Peptide

SPPPIGLSPK

Modified Peptide

n[230]SPPPIGLSPK

Peptide Length

10

ORF Length

56

Open Reading Frame (ORF)

LQHSFMKSPPPIGLSPKKKLFIPTVFYLVILHSQLPINALLLFTLMVYTVSSSHHS

Conservation Score

0

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.553453

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9993

PhyloCSF Frame 3

0

CNTI Score

-0.464283949