McDonnell Genome Institute

Washington University

Transcript

lnc-PRORY-4:1

Chromosome

chrY

Gene Name

lnc-PRORY-4

Start

21430696

CPC Label

coding

End

21437245

Cancer

BRCA-Basal-like

Strand

-

Peptide

DLGCLMVEAAIMIITILEIDMAEVGR

Modified Peptide

n[145]DLGCLM[147]VEAAIMIITILEIDM[147]AEVGR

Peptide Length

26

ORF Length

286

Open Reading Frame (ORF)

LHGKAIKLEQARKPSFQSCGRRRPPPSSKNRTPAGSLRSGRRSSGGTRGWLLSYEGHFDDGGYTPDLNMSSSRGPIPVKRGPSSRSRVPPLKKSALSAMVRSNSWMGGQDPISCGRENYGGPPCRVTISSWINDHMSPRDDGYAIKERHHPSSRETRDYAPPPRGYAYCDYGHSSQDEHSSRGYNDHGGYSEACGRDLSQCASGSSYRDAFQRYGPLMVQHLHKDLGCLMVEAAIMIITILEIDMAEVGRVTQGVAVIFIPVVMSTLAEKTEGIHLLWIGCTLLLM

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.999489

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5622

PhyloCSF Frame 3

0

CNTI Score

-0.36811108