McDonnell Genome Institute

Washington University

Transcript

lnc-PRORY-2:1

Chromosome

chrY

Gene Name

lnc-PRORY-2

Start

21221105

CPC Label

noncoding

End

21222089

Cancer

HCC

Strand

-

Peptide

LLSQSTVK

Modified Peptide

n[230]LLSQSTVK

Peptide Length

8

ORF Length

37

Open Reading Frame (ORF)

LLSQSTVKRVYAMQGTRNKVSQSHYLLKTKNLEIKAC

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.0331856

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9989

PhyloCSF Frame 3

0

CNTI Score

-0.326614326