McDonnell Genome Institute

Washington University

Transcript

lnc-PROP1-2:2

Chromosome

chr5

Gene Name

lnc-PROP1-2

Start

177960460

CPC Label

coding

End

177964277

Cancer

OV

Strand

-

Peptide

MSPREGQILK

Modified Peptide

n[145]MSPREGQILK

Peptide Length

10

ORF Length

78

Open Reading Frame (ORF)

MSPREGQILKHMRQRGPISQNRVNEAHTKGVLISFISKEAAVTLDGEAHHRKLAAEDLSGMASSHGFCCGFHFNLVND

Conservation Score

0.035

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.98675

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4954

PhyloCSF Frame 3

0

CNTI Score

-0.366778807