McDonnell Genome Institute

Washington University

Transcript

lnc-PROP1-2:1

Chromosome

chr5

Gene Name

lnc-PROP1-2

Start

177960470

CPC Label

coding

End

177965854

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

LSSSAGVISVAR

Modified Peptide

n[145]LSSSAGVISVAR

Peptide Length

12

ORF Length

62

Open Reading Frame (ORF)

LDFLCAFNASLSMARMKTSENTNCWRGWGATKLSSSAGVISVARSTWETLSVAAESGQAHLR

Conservation Score

0.083

PhyloCSF Frame 1

-4.929

No. of Spectra

18

CPC Coding Probability

0.995605

PhyloCSF Frame 2 

-3.853

CNTI Index

noncoding

Max Probability

0.9998

PhyloCSF Frame 3

-4.439

CNTI Score

-0.361926755