McDonnell Genome Institute

Washington University

Transcript

lnc-PROK1-4:2

Chromosome

chr1

Gene Name

lnc-PROK1-4

Start

110508190

CPC Label

noncoding

End

110725820

Cancer

OV

Strand

+

Peptide

IMLLALGEMVVYICMTR

Modified Peptide

n[145]IM[147]LLALGEMVVYICMTR

Peptide Length

17

ORF Length

61

Open Reading Frame (ORF)

LVTLNGLISLWFLNKELDIFILYWALKIMLLALGEMVVYICMTRVKKQSWNHRSREDSPIN

Conservation Score

0.104

PhyloCSF Frame 1

-3.862

No. of Spectra

35

CPC Coding Probability

0.141048

PhyloCSF Frame 2 

-5.157

CNTI Index

noncoding

Max Probability

0.9946

PhyloCSF Frame 3

-4.2

CNTI Score

-0.36230923