McDonnell Genome Institute

Washington University

Transcript

lnc-PROK1-2:3

Chromosome

chr1

Gene Name

lnc-PROK1-2

Start

110473826

CPC Label

noncoding

End

110474977

Cancer

BRCA-Luminal B

Strand

+

Peptide

LLFESLIK

Modified Peptide

n[145]LLFESLIK

Peptide Length

8

ORF Length

37

Open Reading Frame (ORF)

LLFESLIKERVGGVGCGWVGSYIKDRLTGESFAMPRN

Conservation Score

0.061

PhyloCSF Frame 1

-5.161

No. of Spectra

2

CPC Coding Probability

0.0130532

PhyloCSF Frame 2 

-4.137

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

-5.042

CNTI Score

-0.45443772