McDonnell Genome Institute

Washington University

Transcript

lnc-PROK1-2:1

Chromosome

chr1

Gene Name

lnc-PROK1-2

Start

110473755

CPC Label

noncoding

End

110488663

Cancer

OSCC

Strand

+

Peptide

DLAKITQLIK

Modified Peptide

n[145]DLAKITQLIK

Peptide Length

10

ORF Length

83

Open Reading Frame (ORF)

LKRKRDLAKITQLIKAKHPRNLQRGFSLSFLCRSYVGSTESQRENHQRFDPSKSSTHRTWASPCPSSMAQAACGACWAMTLSP

Conservation Score

1

PhyloCSF Frame 1

-0.889

No. of Spectra

9

CPC Coding Probability

0.184782

PhyloCSF Frame 2 

-5.526

CNTI Index

noncoding

Max Probability

0.6889

PhyloCSF Frame 3

6.035

CNTI Score

-0.289707495