McDonnell Genome Institute

Washington University

Transcript

lnc-PRODH2-5:5

Chromosome

chr19

Gene Name

lnc-PRODH2-5

Start

35788875

CPC Label

noncoding

End

35797885

Cancer

BRCA-Luminal A

Strand

-

Peptide

MDLLEEIIAELQK

Modified Peptide

n[145]MDLLEEIIAELQK

Peptide Length

13

ORF Length

78

Open Reading Frame (ORF)

LTRGGLFSSLQKMDLLEEIIAELQKGCQLGEKPSLSPTPDLDSQGAHGSPLCRYHLSEAPRSNSCLGASPKGNRMIKC

Conservation Score

0.907

PhyloCSF Frame 1

-4.004

No. of Spectra

16

CPC Coding Probability

0.0809108

PhyloCSF Frame 2 

-3.488

CNTI Index

noncoding

Max Probability

0.9949

PhyloCSF Frame 3

-2.934

CNTI Score

-0.267380081