McDonnell Genome Institute

Washington University

Transcript

lnc-PRODH2-1:5

Chromosome

chr19

Gene Name

lnc-PRODH2-1

Start

35818422

CPC Label

noncoding

End

35820704

Cancer

OV

Strand

-

Peptide

LVLPLDACNALQSMLQPK

Modified Peptide

n[145]LVLPLDACNALQSMLQPK

Peptide Length

18

ORF Length

35

Open Reading Frame (ORF)

LVLPLDACNALQSMLQPKTIMQISQAPTRVRSCPV

Conservation Score

1

PhyloCSF Frame 1

-1.837

No. of Spectra

2

CPC Coding Probability

0.268023

PhyloCSF Frame 2 

-4.816

CNTI Index

noncoding

Max Probability

0.9703

PhyloCSF Frame 3

-5.953

CNTI Score

-0.349663086