McDonnell Genome Institute

Washington University

Transcript

lnc-PROC-5:1

Chromosome

chr2

Gene Name

lnc-PROC-5

Start

127247257

CPC Label

coding

End

127250082

Cancer

CCRC

Strand

+

Peptide

LDEMEFNPLQQPQLNEK

Modified Peptide

n[230]LDEMEFNPLQQPQLNEK

Peptide Length

17

ORF Length

57

Open Reading Frame (ORF)

LRPARAAFLKMKDPKQITRDMEKLDEMEFNPLQQPQLNEKVLKNRRKKLRETFEHIL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.551765

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9941

PhyloCSF Frame 3

0

CNTI Score

0.653654563