McDonnell Genome Institute

Washington University

Transcript

lnc-PRMT8-8:1

Chromosome

chr12

Gene Name

lnc-PRMT8-8

Start

3752517

CPC Label

noncoding

End

3757842

Cancer

OSCC

Strand

+

Peptide

DLQIWSPSK

Modified Peptide

n[145]DLQIWSPSK

Peptide Length

9

ORF Length

34

Open Reading Frame (ORF)

MQGLPEDISENHVLPLRDLQIWSPSKTGQVRHEQ

Conservation Score

0.221

PhyloCSF Frame 1

-4.671

No. of Spectra

2

CPC Coding Probability

0.419415

PhyloCSF Frame 2 

-4.578

CNTI Index

noncoding

Max Probability

0.9933

PhyloCSF Frame 3

-5.873

CNTI Score

-0.334524633