McDonnell Genome Institute

Washington University

Transcript

lnc-PRMT6-9:1

Chromosome

chr1

Gene Name

lnc-PRMT6-9

Start

105891738

CPC Label

coding

End

105893517

Cancer

OV

Strand

+

Peptide

GAPPSSNIEDFHGLLLK

Modified Peptide

n[145]GAPPSSNIEDFHGLLLK

Peptide Length

17

ORF Length

220

Open Reading Frame (ORF)

LMIMVLVSTWCLIMIMEVILENLAIMTEWIMKMTDYEMEKRCRDDSFFGETSRNYHKFDSEYERMGLGHGPDPLQERSLFEKKRGAPPSSNIEDFHGLLLKGYTHLCSICDLPVHSNEELSQHINRASHSRRCQLLLEIYPEWDPDNDTKHTMGDPFMSQQSTNPAPGILGSPPPSFHLGGPAIGPRGNLGAGNGNLQRTRHIQNGRVETSRVVHIMDFQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.999259

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

-0.352740785