McDonnell Genome Institute

Washington University

Transcript

lnc-PRMT6-15:1

Chromosome

chr1

Gene Name

lnc-PRMT6-15

Start

106329327

CPC Label

coding

End

106337810

Cancer

PRAD

Strand

+

Peptide

KEHIEHPR

Modified Peptide

Peptide Length

8

ORF Length

36

Open Reading Frame (ORF)

LLTLEKLKNLFLNLIGFRNSHNFYRKEHIEHPRMKR

Conservation Score

1

PhyloCSF Frame 1

-5.202

No. of Spectra

2

CPC Coding Probability

0.999967

PhyloCSF Frame 2 

-5.828

CNTI Index

coding

Max Probability

0.9986

PhyloCSF Frame 3

-6.001

CNTI Score

0.696139382