McDonnell Genome Institute

Washington University

Transcript

lnc-PRMT6-14:1

Chromosome

chr1

Gene Name

lnc-PRMT6-14

Start

106411843

CPC Label

noncoding

End

106412875

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

SISTWQPPCPGGR

Modified Peptide

n[145]SISTWQPPCPGGR

Peptide Length

13

ORF Length

72

Open Reading Frame (ORF)

LPSSCPVWEVRSISTWQPPCPGGRWGGQPPARPAAPSGREVGVSAPHPASHPVREGGGGVSPPARPAAKSGR

Conservation Score

0

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0179001

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7053

PhyloCSF Frame 3

0

CNTI Score

-0.336816423