McDonnell Genome Institute

Washington University

Transcript

lnc-PRMT6-12:1

Chromosome

chr1

Gene Name

lnc-PRMT6-12

Start

106877604

CPC Label

noncoding

End

106878783

Cancer

BRCA-Luminal A

Strand

+

Peptide

WVLGSPK

Modified Peptide

n[145]WVLGSPK

Peptide Length

7

ORF Length

81

Open Reading Frame (ORF)

LRAIIEADPLTTTREVAEELIVDHFMIVRHLKQIGKVKKLNKWVLGSPKQTIPFPSHRPYNTVSCALHTVTPGQKTNPPLH

Conservation Score

0.423

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0345086

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7939

PhyloCSF Frame 3

0

CNTI Score

-0.345009615