McDonnell Genome Institute

Washington University

Transcript

lnc-PRM1-5:1

Chromosome

chr16

Gene Name

lnc-PRM1-5

Start

11349690

CPC Label

noncoding

End

11399255

Cancer

OSCC

Strand

-

Peptide

GCVEMEAPHMLGGTWR

Modified Peptide

n[145]GCVEMEAPHMLGGTWR

Peptide Length

16

ORF Length

127

Open Reading Frame (ORF)

LPASASQSAGITGVSHCAQPNFIHINMLKIIIIVDVEKVIEKRSTLKRCHINIKRGCVEMEAPHMLGGTWRHGNSKTQFGGFLKGEYKSTRLSQENSLNLGGRGCSEPRSCHCTPAWATDGDCLLDR

Conservation Score

0.873

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0902015

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9267

PhyloCSF Frame 3

0

CNTI Score

-0.297364604