McDonnell Genome Institute

Washington University

Transcript

lnc-PRM1-1:3

Chromosome

chr16

Gene Name

lnc-PRM1-1

Start

11335909

CPC Label

noncoding

End

11345288

Cancer

CCRC

Strand

-

Peptide

FYENTHIHAHK

Modified Peptide

n[230]FYENTHIHAHK

Peptide Length

11

ORF Length

42

Open Reading Frame (ORF)

MVVLNITSYPLSWIGTVEEYSGEFFFWKYRFYENTHIHAHKF

Conservation Score

0.216

PhyloCSF Frame 1

0

No. of Spectra

43

CPC Coding Probability

0.0295342

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9638

PhyloCSF Frame 3

0

CNTI Score

-0.361819241